PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG297000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 150aa    MW: 17125 Da    PI: 11.5303
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG297000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.11.9e-1286115231
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLC 31 
                          rien + +qv fskR+ g+ KKA+ LS LC
  Pavir.5KG297000.1.p  86 RIENRTTQQVRFSKRQSGLCKKAHDLSMLC 115
                          8***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-677127IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.54977115IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-1378116IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-137999IPR002100Transcription factor, MADS-box
PfamPF003192.4E-1186116IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-1399114IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MQIWCAPSPA LLCYPLRSMH TSSAQFSAPR STPTRPRVST PRPPPLPVRA AHHRHAQVLD  60
TDALLLQQWK KVSKMKRKRG RVELRRIENR TTQQVRFSKR QSGLCKKAHD LSMLCSPIQP  120
QDEPQPSSFV HLSESQNLKH LAMDLLIFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.22e-12AGAMOUS-like 71